PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009690P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 237aa    MW: 25742.9 Da    PI: 9.8354
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009690P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.12e-334599155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  MELO3C009690P1 45 KQRLRWTSDLHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 99
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.0642102IPR017930Myb domain
TIGRFAMsTIGR015573.4E-2645100IPR006447Myb domain, plants
SuperFamilySSF466892.87E-174599IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-3245100IPR009057Homeodomain-like
PfamPF002491.1E-74798IPR001005SANT/Myb domain
PfamPF143793.0E-22131176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MYHAKKFSTA SLVPHKSQGA EQSASVAVLG GSTAKSPMPP GGGGKQRLRW TSDLHDRFVD  60
AITQLGGPDR ATPKGVLRVM GVPGLTIYHV KSHLQKYRLA KYLPESPADG SKDEKRSSES  120
LSGTDSSSGL QINEALRMQM EVQKRLQEQL EVQRQLQMRI EAQAKYLQKI IEEQQKLGGE  180
SKDSEVVPSA EDNKQKTCQS ESYGDVSAGP SSPRKKQRID RGSTDDSAPS PSINLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818411e-143LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132581e-143LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443159.11e-173PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN51e-49PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0A0LF931e-171A0A0A0LF93_CUCSA; Uncharacterized protein
STRINGVIT_08s0040g00100.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130132330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.17e-53G2-like family protein